DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and MORN3

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001350614.1 Gene:MORN3 / 283385 HGNCID:29807 Length:240 Species:Homo sapiens


Alignment Length:111 Identity:32/111 - (28%)
Similarity:52/111 - (46%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QQGQGQSQYSAGAVKVGGWRYEDAS-----------RYIGEWNQRGQKHGIGHLQFADGTRYDGQ 91
            |.|:.:..||      |.|:.:..|           .|.|:| ...|:.|.|.:.:::|..|:||
Human    83 QTGKCRRVYS------GWWKGDKKSGYGIQFFGPKEYYEGDW-CGSQRSGWGRMYYSNGDIYEGQ 140

  Fly    92 FQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRAD-GMKYEG 136
            ::.....|.|.|...:|.:|||.:.:|..:|.|.|:..| |..:||
Human   141 WENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEG 186

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 28/95 (29%)
MORN3NP_001350614.1 COG4642 34..>188 CDD:332236 32/111 (29%)
MORN 1 38..60