DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and MORN5

DIOPT Version :10

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_940871.2 Gene:MORN5 / 254956 HGNCID:17841 Length:161 Species:Homo sapiens


Alignment Length:123 Identity:35/123 - (28%)
Similarity:51/123 - (41%) Gaps:23/123 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWR 128
            |:||... |..||.|.|.|..|::||..::.||:. .|...|:||..|:   .:.|.:.:|.   
Human    31 YVGEMKD-GMFHGEGTLYFPSGSQYDAIWENGLAI-KGTYTFSDGLHYD---EKNWHYCDGY--- 87

  Fly   129 ADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPR-----NEGFFQDC---------RFMR 172
             |...|.....|.|..|:..||..|.....|:     .:||:...         ||:|
Human    88 -DRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 <53..153 CDD:443680 28/88 (32%)
MORN5NP_940871.2 COG4642 <5..76 CDD:443680 18/46 (39%)
MORN 1 8..30
MORN 2 31..53 10/22 (45%)
MORN 3 54..75 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.