DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and Als2cl

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001139531.1 Gene:Als2cl / 235633 MGIID:2447532 Length:952 Species:Mus musculus


Alignment Length:203 Identity:48/203 - (23%)
Similarity:62/203 - (30%) Gaps:99/203 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVG----------------CLW-------- 104
            |.||| .|.:.||.|.|::.||..:.|.|.:||..|.|                |.|        
Mouse   358 YDGEW-CRAKPHGKGTLKWPDGRNHVGTFYQGLEHGFGICLVPQASEDKFDCYKCHWREGRMCEY 421

  Fly   105 ----FADGAKYEGEFHQGWFHGNGI---------------------------------------F 126
                :.....|:|.|..|..||.||                                       .
Mouse   422 GICEYGTDEVYKGYFQAGLRHGFGILESAPQAPQPFRYTGHWERGQRSGYGIEEDRDRGERYIGM 486

  Fly   127 WRAD------------GMKYEGEFRGGKIWGLGLLTFQD-------FTHG----------FPRNE 162
            |:||            |:.|:|.|:|.|:.|.|:|..:|       ||..          ||  .
Mouse   487 WQADQRHGPGVVVTQAGVCYQGTFQGDKMAGPGILLCEDDSLYEGTFTRDLTLLGKGKVTFP--N 549

  Fly   163 GFFQDCRF 170
            ||..|..|
Mouse   550 GFTLDGSF 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 39/165 (24%)
Als2clNP_001139531.1 PH-like 223..321 CDD:388408
PLN03185 357..>550 CDD:215619 44/194 (23%)
MORN 1 358..380 11/22 (50%)
MORN 2 381..403 6/21 (29%)
MORN 3 409..431 2/21 (10%)
MORN 4 432..454 8/21 (38%)
MORN 5 459..481 0/21 (0%)
MORN 6 483..505 4/21 (19%)
MORN 7 506..528 9/21 (43%)
MORN 8 529..552 5/24 (21%)
VPS9 835..937 CDD:388595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.