DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtp and morn4

DIOPT Version :9

Sequence 1:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_002939708.2 Gene:morn4 / 100379992 XenbaseID:XB-GENE-940246 Length:149 Species:Xenopus tropicalis


Alignment Length:139 Identity:70/139 - (50%)
Similarity:94/139 - (67%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQG 118
            |.::|.....|.|||.: |::||||.|.||||:.|.|||:.||..|.|.|.|.||::|||||.||
 Frog     6 GSFKYSSGEEYHGEWKE-GRRHGIGQLLFADGSIYVGQFENGLFSGCGVLTFPDGSRYEGEFVQG 69

  Fly   119 WFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRA 183
            .|.|.|:|.|.|.||:||||:||::.|.||||:.|.:||.|||||.|::.:.::|.:|...:|||
 Frog    70 KFQGTGVFTRYDNMKFEGEFKGGRVEGYGLLTYSDGSHGIPRNEGLFENNKLVKREKCQTAIQRA 134

  Fly   184 QKCALMARS 192
            ...:..|.|
 Frog   135 LSASKAACS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtpNP_649520.1 COG4642 54..>151 CDD:332236 53/96 (55%)
morn4XP_002939708.2 COG4642 <5..98 CDD:226989 50/92 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16635
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52381
OrthoDB 1 1.010 - - D1532474at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46614
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.