DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rtp and als2b

DIOPT Version :9

Sequence 1:	NP_649520.1	Gene:	rtp / 40627	FlyBaseID:	FBgn0087005	Length:	198	Species:	Drosophila melanogaster
Sequence 2:	XP_009300450.1	Gene:	als2b / 100318899	ZFINID:	ZDB-GENE-080929-1	Length:	1706	Species:	Danio rerio

Alignment Length:	131	Identity:	42/131 - (32%)
Similarity:	62/131 - (47%)	Gaps:	20/131 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 QHGHHQQGQGQSQYSAGAVKVGGWRYEDAS------------RYIGEW--NQRGQKHGIGHLQFA 83
            :|||.....|:...::.:|.:|.|:|:..|            :|:|.|  :|| |.:|:...||
Zfish  1187 RHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQR-QGNGVVVTQF- 1249

  Fly    84 DGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGW-FHGNGIFWRADGMKYEGEFRGGKIWGLG 147
             |..|:|.|......|.|.|...|...:||||.:.| .:|.|:....:|...||.|.|  :||.|
Zfish  1250 -GLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKGVLTMPNGDYIEGSFCG--VWGTG 1311

  Fly   148 L 148
            |
Zfish  1312 L 1312

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rtp	NP_649520.1	COG4642	54..>151	CDD:332236	37/110 (34%)
als2b	XP_009300450.1	RCC1_2	88..117	CDD:290274
		RCC1	104..160	CDD:278826
		RCC1	165..211	CDD:278826
		RCC1	567..614	CDD:278826
		RCC1	619..665	CDD:278826
		PH_alsin	952..1065	CDD:241423
		COG4642	1085..1290	CDD:226989	32/105 (30%)
		MORN	1104..1124	CDD:280628
		MORN	1153..1173	CDD:197832
		VPS9	1603..1702	CDD:280383
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900