DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and VPS37-1

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_190880.1 Gene:VPS37-1 / 824478 AraportID:AT3G53120 Length:217 Species:Arabidopsis thaliana


Alignment Length:148 Identity:44/148 - (29%)
Similarity:77/148 - (52%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDDKLDE---KVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSED 80
            :||::||:|.|...:   .:|:| :|....|..:..:....|..|:|:||||:|||.|...:.  
plant    68 DELRKLLSDKDAYQQFLLSLDQV-KVQNNIKDELRRETLQLARDNLEKEPQIMELRNQCRIIR-- 129

  Fly    81 GRTRCSSVQEKLSQLKEK--------SGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVE 137
             .|..::.||||::|:.:        |.|    :.|..||.|.::.:|::|.:.:||.:.:|...
plant   130 -TTELATAQEKLNELERQKEEILKFYSPG----SLLHKLQEAMNQVDEESEALQEKFLEKEIDTA 189

  Fly   138 DFLDAFLPIRRTMHLRRL 155
            .|:..:..:|.|.|.|.|
plant   190 AFVQKYKKLRTTYHRRAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 8/25 (32%)
Mod_r 19..153 CDD:284587 42/144 (29%)
VPS37-1NP_190880.1 Mod_r 63..205 CDD:284587 42/144 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3864
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.