DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and AT2G36680

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_850268.2 Gene:AT2G36680 / 818240 AraportID:AT2G36680 Length:218 Species:Arabidopsis thaliana


Alignment Length:151 Identity:47/151 - (31%)
Similarity:80/151 - (52%) Gaps:25/151 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSR----AERNIEREPQIIELRGQ--LAEL 77
            :||::||:|.|...:.:..:.||  |.:.::.|:.|..    |..|:|:||||:|||.|  :...
plant    68 DELRKLLSDKDAYQQFLHSLDQV--TIQNNIREELRKETLHLARENLEKEPQIVELRNQCRIIRT 130

  Fly    78 SEDGRTRCSSVQEKLSQLKEK--------SGGVGLETALALLQTAASESEEQTEEMVKKFNDSDI 134
            ||     .::.||||::|:.:        |.|    :.|..||.|.::.:|::||:.:||.:.||
plant   131 SE-----LATAQEKLNELENQREEILKFYSPG----SLLHRLQDAMNQVDEESEELQQKFMEKDI 186

  Fly   135 GVEDFLDAFLPIRRTMHLRRL 155
            ....|:..:..:|...|.|.|
plant   187 DTAAFVQKYKKLRSKYHRRAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 7/22 (32%)
Mod_r 19..153 CDD:284587 45/147 (31%)
AT2G36680NP_850268.2 KLF8_12_N <10..>53 CDD:424081
Mod_r 63..206 CDD:399880 45/148 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3864
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.