DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37c

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001071253.1 Gene:vps37c / 777738 ZFINID:ZDB-GENE-061110-126 Length:323 Species:Danio rerio


Alignment Length:260 Identity:66/260 - (25%)
Similarity:115/260 - (44%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MCHEELKELLNDDDKLDE---KVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAEL 77
            :...||::||::.::::.   :.||: |.::.::......|||.||:|::.:|:|...|.:|.| 
Zfish     7 LSQSELQDLLDNLERVESMALESDEI-QNIQLEREMALAANRSLAEQNLDMKPRIENDRARLVE- 69

  Fly    78 SEDGRTRCSSVQEKLSQ---LKEK-SGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVED 138
               ..|...:|:||..|   |::. .|.|..|..|:.||...:.:|.::|.:..:|.:..|.::.
Zfish    70 ---KYTELEAVREKYKQHCVLRDSIMGQVSPEGLLSRLQAEGASTEAESEALADEFLEGSISLDS 131

  Fly   139 FLDAFLPIRRTMHLRRLKAEKMQELMRK--------------------------QRQGPGPNTSL 177
            ||:.||.:|...|.||::.||:||::.:                          |:|.|..::.:
Zfish   132 FLERFLSLRSLAHTRRVRIEKLQEILSQKSKGIGDATIASQPCASQDAGSSSPWQQQQPQQSSKI 196

  Fly   178 PAYGNVPSSGF----YPASGGSA-------------PYPIMGPLMPMP-----------PPSRPY 214
            .|..|..||..    ||.:..||             |||..|...|..           ||:.||
Zfish   197 NAPSNASSSALPYSPYPVAPPSASTAGSTNPSTAFQPYPSQGAPFPQATGFPAPRPAFGPPACPY 261

  Fly   215  214
            Zfish   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 7/28 (25%)
Mod_r 19..153 CDD:284587 40/140 (29%)
vps37cNP_001071253.1 Mod_r 5..146 CDD:284587 40/143 (28%)
CENP-H 9..93 CDD:283493 24/88 (27%)
MFMR 210..298 CDD:285072 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107562
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5541
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.