DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37bb

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001025385.1 Gene:vps37bb / 566797 ZFINID:ZDB-GENE-050913-110 Length:231 Species:Danio rerio


Alignment Length:225 Identity:67/225 - (29%)
Similarity:103/225 - (45%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDDKL-------DEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAE 76
            |::.|:|.|::||       .||     |.::..|..:...|||.||.|:..:|.:...:.||.:
Zfish    17 EQIMEILEDEEKLTSIARDSGEK-----QEMQQSKELMMASNRSLAEMNLNLQPDLDHQKIQLTK 76

  Fly    77 LSEDGRTRCSSVQEKLSQLKEKS-GGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFL 140
                 |..|.....:..||:..: |...|:|.||||||..::.||:||.|...|.|..:.::.|:
Zfish    77 -----RYCCLQELHESYQLRRSTLGSSSLDTLLALLQTEGAKIEEETENMADSFLDGSMPLDSFI 136

  Fly   141 DAFLPIRRTMHLRRLKAEKMQELMRK-------------------QRQG--------PGPNTSLP 178
            |.:...|:..||||:|.:|:||::.|                   ||..        |....|..
Zfish   137 DDYQSKRKLAHLRRVKIDKLQEMLLKGIHLPQGSSNEHQESLNSFQRLSNGSPAHVKPTSQASAS 201

  Fly   179 AYGNVPSSGFYPASGGSAPYPIMGPLMPMP 208
            .|.|:|::  .|:|..|| || .||...:|
Zfish   202 PYANLPNA--MPSSYSSA-YP-QGPGSALP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 9/29 (31%)
Mod_r 19..153 CDD:284587 43/141 (30%)
vps37bbNP_001025385.1 Mod_r 15..149 CDD:284587 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595854
Domainoid 1 1.000 84 1.000 Domainoid score I8181
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11649
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45937
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm25656
orthoMCL 1 0.900 - - OOG6_107562
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.