DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37ba

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001093466.1 Gene:vps37ba / 559483 ZFINID:ZDB-GENE-060526-254 Length:288 Species:Danio rerio


Alignment Length:230 Identity:67/230 - (29%)
Similarity:108/230 - (46%) Gaps:39/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVDEVLQV--LRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            :|.|||.|||||::.:||..::  |:..|.:...:||..||:|:..:|::...:.:|.......:
Zfish    15 QLNELLEDDDKLNKFIDESEEIKGLQQNKETTLANNRFLAEQNLLLQPKLDHQKNELTRRYRGLQ 79

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            ....:.|.:.|.|.::.|...|:|.|||||...::.||:||.:...|.|....::.|:|.:...|
Zfish    80 ELYEAYQLRKSTLDDRLGNTPLDTLLALLQAEGAKIEEETENLADAFLDGAAPLDTFIDDYQSKR 144

  Fly   148 RTMHLRRLKAEKMQELMRKQRQGPGPNTSLPAYG-NVPSSGFYPA------SGGSAPYPIMGPLM 205
            :..||||:|.||:||::.|....| |....|:.. ::||.   ||      :|...|.|...|.:
Zfish   145 KLAHLRRVKIEKLQEMVLKGHHMP-PAAPPPSRAQDLPSR---PAALNREVNGSPMPMPRRAPPL 205

  Fly   206 P--------------------------MPPPSRPY 214
            |                          |.||:.||
Zfish   206 PPVKESPQPAPTTAISYPPTSPFPSPSMIPPTSPY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 11/23 (48%)
Mod_r 19..153 CDD:284587 41/134 (31%)
vps37baNP_001093466.1 Mod_r 12..150 CDD:284587 41/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595853
Domainoid 1 1.000 84 1.000 Domainoid score I8181
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11649
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45937
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm25656
orthoMCL 1 0.900 - - OOG6_107562
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5541
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.