Sequence 1: | NP_001246926.1 | Gene: | Vps37B / 40624 | FlyBaseID: | FBgn0037299 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060436.4 | Gene: | VPS37C / 55048 | HGNCID: | 26097 | Length: | 355 | Species: | Homo sapiens |
Alignment Length: | 327 | Identity: | 76/327 - (23%) |
---|---|---|---|
Similarity: | 119/327 - (36%) | Gaps: | 132/327 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 EELKELLNDDDKLDEKVDE--VLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDG 81
Fly 82 RTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPI 146
Fly 147 RRTMHLRRLKAEKMQELMRKQR----------------------QG--------PGPNTSLPAY- 180
Fly 181 ----------------------------------------------------------------- 180
Fly 181 -------------------GNVPSSGF-----YPASGGSAPYPIM----------GPLMPMPPPS 211
Fly 212 RP 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vps37B | NP_001246926.1 | PABP | <16..42 | CDD:295409 | 9/24 (38%) |
Mod_r | 19..153 | CDD:284587 | 42/135 (31%) | ||
VPS37C | NP_060436.4 | Mod_r | 5..146 | CDD:284587 | 42/135 (31%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..355 | 26/178 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165159647 | |
Domainoid | 1 | 1.000 | 85 | 1.000 | Domainoid score | I8171 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3270 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 106 | 1.000 | Inparanoid score | I4942 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1197293at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003711 | |
OrthoInspector | 1 | 1.000 | - | - | otm40312 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13678 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5541 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
13 | 12.890 |