DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and VPS37C

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_060436.4 Gene:VPS37C / 55048 HGNCID:26097 Length:355 Species:Homo sapiens


Alignment Length:327 Identity:76/327 - (23%)
Similarity:119/327 - (36%) Gaps:132/327 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDDKLDEKVDE--VLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDG 81
            :||:||.||.:.:|:...|  .:|.|:.::......|||.||||:|.:..:...|..|::..::.
Human    10 QELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQEL 74

  Fly    82 RTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPI 146
            |......||:.::|::.|..:...|.|.|||....:.||::|.|.:||.:.::.:|.||:.|..:
Human    75 RKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAEKFLEGEVPLETFLENFSSM 139

  Fly   147 RRTMHLRRLKAEKMQELMRKQR----------------------QG--------PGPNTSLPAY- 180
            |...||||::.||:||::||.|                      ||        |.|..::|.| 
Human   140 RMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVRPVPQGTPPVVEEQPQPPLAMPPYP 204

  Fly   181 ----------------------------------------------------------------- 180
                                                                             
Human   205 LPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGPLGPTYPAAQLGPRGAAGYSWSPQRSMPPR 269

  Fly   181 -------------------GNVPSSGF-----YPASGGSAPYPIM----------GPLMPMPPPS 211
                               |..||.|:     |||:||..||||.          .|.:|:.||.
Human   270 PGYPGTPMGASGPGYPLRGGRAPSPGYPQQSPYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPY 334

  Fly   212 RP 213
            .|
Human   335 PP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 9/24 (38%)
Mod_r 19..153 CDD:284587 42/135 (31%)
VPS37CNP_060436.4 Mod_r 5..146 CDD:284587 42/135 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..355 26/178 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159647
Domainoid 1 1.000 85 1.000 Domainoid score I8171
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4942
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm40312
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5541
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.