DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37a

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001015982.1 Gene:vps37a / 548736 XenbaseID:XB-GENE-969334 Length:382 Species:Xenopus tropicalis


Alignment Length:155 Identity:41/155 - (26%)
Similarity:79/155 - (50%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQ-LAELSEDGRT 83
            :||::::|.::|...::|:                  |:||::.|| ::|::.| :.:..|....
 Frog   246 QLKQVISDKEELVRNIEEM------------------AKRNLQMEP-VLEVKRQAILDKYEQLMQ 291

  Fly    84 RCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRR 148
            ...|.::||.:..|.|....|....|.|:.||.|:||:::::..:|.:..|.:::||..|:..|.
 Frog   292 LKLSFEKKLQRQHELSESCSLSALQARLKVAAHEAEEESDKIADEFLEGKIEIDEFLVNFMDKRT 356

  Fly   149 TMHLRRLKAEKMQELMRKQRQGPGP 173
            ..|.||.|.||:|:.:....|...|
 Frog   357 CCHSRRAKEEKLQQAISLHSQYHAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 5/21 (24%)
Mod_r 19..153 CDD:284587 33/133 (25%)
vps37aNP_001015982.1 Mod_r 221..365 CDD:399880 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.