DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37a

DIOPT Version :10

Sequence 1:NP_649518.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001015982.1 Gene:vps37a / 548736 XenbaseID:XB-GENE-969334 Length:382 Species:Xenopus tropicalis


Alignment Length:155 Identity:41/155 - (26%)
Similarity:79/155 - (50%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQ-LAELSEDGRT 83
            :||::::|.::|...::|:                  |:||::.|| ::|::.| :.:..|....
 Frog   246 QLKQVISDKEELVRNIEEM------------------AKRNLQMEP-VLEVKRQAILDKYEQLMQ 291

  Fly    84 RCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRR 148
            ...|.::||.:..|.|....|....|.|:.||.|:||:::::..:|.:..|.:::||..|:..|.
 Frog   292 LKLSFEKKLQRQHELSESCSLSALQARLKVAAHEAEEESDKIADEFLEGKIEIDEFLVNFMDKRT 356

  Fly   149 TMHLRRLKAEKMQELMRKQRQGPGP 173
            ..|.||.|.||:|:.:....|...|
 Frog   357 CCHSRRAKEEKLQQAISLHSQYHAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_649518.1 Mod_r 19..157 CDD:462117 35/137 (26%)
vps37aNP_001015982.1 UEV_TSG101-like <49..123 CDD:467408
Mod_r 221..365 CDD:462117 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.