DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37b

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_989045.1 Gene:vps37b / 394642 XenbaseID:XB-GENE-5714906 Length:287 Species:Xenopus tropicalis


Alignment Length:210 Identity:71/210 - (33%)
Similarity:111/210 - (52%) Gaps:25/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVDEV--LQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            ||.|||.|::||...|.|:  .|.::..|......|||.||.|:..:|.:..|:..|.:..::.:
 Frog    15 ELNELLEDEEKLGHIVQEMDEPQNVQLSKEMTLAGNRSLAEGNLLLQPDLETLKATLTQKYQELQ 79

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            :...|.|.|.::|.::|....|||.|||||...::.||:||.|.:.|.|..|.:::|.|.::..|
 Frog    80 SLIESHQLKKTKLDKQSVNSSLETLLALLQAEGAKIEEETENMAENFLDGGIQLDNFTDEYMNKR 144

  Fly   148 RTMHLRRLKAEKMQELMRKQRQGPGPNTSLPAYGNVPSSGFYPA---SGGSAPYPI-------MG 202
            :..||||:|.||:||::.|.::       ||....:|.:|  |:   ....||||.       :.
 Frog   145 KLAHLRRVKIEKLQEMVMKGQR-------LPQVSVLPQAG--PSETNQAPQAPYPTNFATPLPVT 200

  Fly   203 PLMPMPP----PSRP 213
            |..|:||    ||:|
 Frog   201 PRRPVPPPPQAPSQP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 11/23 (48%)
Mod_r 19..153 CDD:284587 46/134 (34%)
vps37bNP_989045.1 Mod_r 25..154 CDD:369259 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8327
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11649
Inparanoid 1 1.050 101 1.000 Inparanoid score I4860
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm47489
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.