DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps37a

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_956284.1 Gene:vps37a / 336368 ZFINID:ZDB-GENE-030131-8312 Length:387 Species:Danio rerio


Alignment Length:159 Identity:47/159 - (29%)
Similarity:78/159 - (49%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MCHEELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAEL--S 78
            ||..:||::.:|.::|...:.|:                  |::|::.|||   |.|:..|:  .
Zfish   247 MCLPQLKQVTSDKEELVNSIVEM------------------AKKNLQLEPQ---LEGKRQEMLCK 290

  Fly    79 EDGRTRCSSVQE-KLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDA 142
            .:..|:..||.| |:.:..|.|....|....|.|:.||.::||::||..:.|.:....::|||.:
Zfish   291 YEQLTQMKSVFETKMQRQHELSESCSLSALQARLKVAAHQAEEESEETAENFLEGKTEIDDFLAS 355

  Fly   143 FLPIRRTMHLRRLKAEKMQELMRKQRQGP 171
            |:..|...|.||.|.||:|:.|....|.|
Zfish   356 FMEKRTLCHSRRAKEEKLQQCMNTHGQFP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 7/25 (28%)
Mod_r 19..153 CDD:284587 36/136 (26%)
vps37aNP_956284.1 Mod_r 225..366 CDD:284587 38/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.