DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and Vps37b

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001099398.1 Gene:Vps37b / 288659 RGDID:1304576 Length:285 Species:Rattus norvegicus


Alignment Length:208 Identity:69/208 - (33%)
Similarity:107/208 - (51%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVD--EVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            :|.|||.||.:|.:.|.  |..|.::..|......|||.||.|:..:||:...:.:|.:..::.:
  Rat    17 QLHELLEDDAQLGDMVRGMEETQTVQHNKEMTLASNRSLAEGNLLYQPQLDAQKARLTQKYQELQ 81

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            ....:.|.|.::|.::|....|||.|||||...::.||.||.|.:||.|.::.::.|:|.:...|
  Rat    82 VLFEAYQIKKTKLDKQSNSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDAFIDVYQSKR 146

  Fly   148 RTMHLRRLKAEKMQELMRKQRQGPGPNTSLPAYGNVPSSGFYPASGGSAPYPIMGPL-------- 204
            :..|:||:|.||:|||:.|.::.|.....||.  .||.    |:...:.|||   ||        
  Rat   147 KLAHIRRVKVEKLQELVLKGQRLPQAGVPLPP--RVPE----PSPATALPYP---PLEATGLPSV 202

  Fly   205 ----MPMPPPSRP 213
                :|.|||..|
  Rat   203 VPRRIPPPPPPVP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 10/23 (43%)
Mod_r 19..153 CDD:284587 44/134 (33%)
Vps37bNP_001099398.1 Mod_r 11..152 CDD:284587 44/134 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353695
Domainoid 1 1.000 82 1.000 Domainoid score I8215
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11649
Inparanoid 1 1.050 103 1.000 Inparanoid score I4859
OMA 1 1.010 - - QHG45937
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm44440
orthoMCL 1 0.900 - - OOG6_107562
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.