DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and Vps37d

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001186606.1 Gene:Vps37d / 194309 MGIID:2159402 Length:261 Species:Mus musculus


Alignment Length:207 Identity:56/207 - (27%)
Similarity:99/207 - (47%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDE--KVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            :|::||.|:.|||.  ::....|.|:.::.:....|.:.|:.|:...|::...|..||...::.|
Mouse    26 QLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLASNYALAKENLALRPRLEMGRTALAIKYQELR 90

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            ....:..:||.:|::.......:.||..||....|:|::.|..:::....:..:|.||.||...|
Mouse    91 EVAENCADKLQRLEKSMHRWSPQCALGWLQAELEEAEQEAEVQMEQLLLGEQSLEAFLPAFQRGR 155

  Fly   148 RTMHLRRLKAEKMQELMRKQRQG--PGPNTSLPAYGNV---------PSSGFYPASGGSAPYPIM 201
            ...||||.:|||:||::|::.:.  |.|.|:..|....         |::...|......|.|.:
Mouse   156 ALAHLRRTQAEKLQEVLRRRERSAQPAPTTAAAAAAAATAMDPPKPFPAAAVLPTGAARGPPPAV 220

  Fly   202 GPLMPMPPPSRP 213
            ...:| |..|||
Mouse   221 PRSLP-PLDSRP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 8/23 (35%)
Mod_r 19..153 CDD:284587 34/134 (25%)
Vps37dNP_001186606.1 Mod_r 22..165 CDD:399880 37/138 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..261 14/61 (23%)
PTZ00449 <198..>259 CDD:185628 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4943
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42377
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.