DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and vps-37

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_504474.1 Gene:vps-37 / 178944 WormBaseID:WBGene00016990 Length:234 Species:Caenorhabditis elegans


Alignment Length:214 Identity:63/214 - (29%)
Similarity:103/214 - (48%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ATITPMCHEELKELLNDDDKLDEKVDEVLQV--LRTQKTSVFEDNRSRAERNIEREPQIIELRGQ 73
            |.:..|.:|:|..||:||..|:..:..:.||  :.|.|.|....|:|.||.|:.::|:|...:.|
 Worm    20 ANLRNMTNEQLISLLDDDALLESIIVNLPQVRSMPTDKESALAANKSLAEWNLAQKPRIDAAKTQ 84

  Fly    74 LAELSEDGRTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVED 138
            ..:|.:..:.....|....|||...|....|:|..:|:|.||.|:::..|.:..:|.:.:|.||.
 Worm    85 TVDLYDQVKKLQGEVAVLKSQLDSVSSSKSLDTTSSLMQVAAQEADDDAEALFTQFENGEISVEI 149

  Fly   139 FLDAFLPIRRTMHLRRLKAEKMQELMRKQRQG---------------PGPNTS--LPAYGNVP-S 185
            ||..|...:...|||::|::::..|:|:|...               ||..|.  :|..||:. .
 Worm   150 FLKQFKDKKTIAHLRKIKSDRLAALLREQTYSSYAQPTVPPPMPHAQPGYPTGNHMPGIGNIQFG 214

  Fly   186 SGF--YP----ASGGSAPY 198
            ||:  ||    .|.|..|:
 Worm   215 SGYSGYPNISQPSAGRHPF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 10/27 (37%)
Mod_r 19..153 CDD:284587 42/135 (31%)
vps-37NP_504474.1 Mod_r 23..167 CDD:369259 45/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167183
Domainoid 1 1.000 71 1.000 Domainoid score I6193
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3751
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45937
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - oto17973
orthoMCL 1 0.900 - - OOG6_107562
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5541
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.