DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and VPS37D

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001071089.1 Gene:VPS37D / 155382 HGNCID:18287 Length:251 Species:Homo sapiens


Alignment Length:201 Identity:58/201 - (28%)
Similarity:100/201 - (49%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDE--KVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            :|::||.|:.|||.  ::....|.|:.::.:....|.:.|:.|:...|::...|..||...::.|
Human    26 QLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELR 90

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            ....:..:||.:|:|.........||..||....|:|::.||.:::....:..:|.||.||...|
Human    91 EVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGR 155

  Fly   148 RTMHLRRLKAEKMQELMRKQRQG--PGPNTSLPAYGNVPSSGFYPASGGSAPYPIMGPLMP--MP 208
            ...||||.:|||:|||:|::.:.  |.|.::.....:.|::...|......|     |.:|  :|
Human   156 ALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGP-----PAVPRSLP 215

  Fly   209 P-PSRP 213
            | .|||
Human   216 PLDSRP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 8/23 (35%)
Mod_r 19..153 CDD:284587 36/134 (27%)
VPS37DNP_001071089.1 Mod_r 22..165 CDD:399880 39/138 (28%)
pneumo_PspA <138..>248 CDD:411490 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..251 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159645
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40312
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.