DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and VPS37A

DIOPT Version :10

Sequence 1:NP_649518.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_689628.2 Gene:VPS37A / 137492 HGNCID:24928 Length:397 Species:Homo sapiens


Alignment Length:154 Identity:38/154 - (24%)
Similarity:72/154 - (46%) Gaps:18/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGRTR 84
            :||:::.|.|.|.:.::|:                  |.:|:..||.:...|..:.:..|.....
Human   261 QLKQIITDKDDLVKSIEEL------------------ARKNLLLEPSLEAKRQTVLDKYELLTQM 307

  Fly    85 CSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRRT 149
            .|:.::|:.:..|.|.........|.|:.||.|:||:::.:.:.|.:..:.::|||.:|:..|..
Human   308 KSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTI 372

  Fly   150 MHLRRLKAEKMQELMRKQRQGPGP 173
            .|.||.|.||:|:.:....|...|
Human   373 CHCRRAKEEKLQQAIAMHSQFHAP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_649518.1 Mod_r 19..157 CDD:462117 32/136 (24%)
VPS37ANP_689628.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UEV_TSG101-like <70..131 CDD:467408
Mod_r 235..380 CDD:462117 32/136 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.