DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and Vsp37A

DIOPT Version :10

Sequence 1:NP_649518.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_312401.5 Gene:Vsp37A / 1273425 VectorBaseID:AGAMI1_005869 Length:321 Species:Anopheles gambiae


Alignment Length:168 Identity:44/168 - (26%)
Similarity:77/168 - (45%) Gaps:33/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDDKLDEKV----------DEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQ 73
            :||..|..|:|.|:|.|          ||:.|:|...: |:..||.:|.:...||:.::..|..:
Mosquito   166 DELSRLNADEDYLEEFVAKLPFLQHQNDELDQLLAGIE-SLAVDNLARKQTVEERKAKLESLALE 229

  Fly    74 LAELSEDGRTRCSSVQEKL-----SQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKF--ND 131
            ..||.:...:.....|.|.     ..:||            |||.|.|.::.::::..::|  ..
Mosquito   230 FKELGQQWESMNQRYQRKAEDFSPQHIKE------------LLQIAVSTADSKSDDEAQRFLAGQ 282

  Fly   132 SDIGVEDFLDAFLPIRRTMHLRRLKAEKM-QELMRKQR 168
            ||:|.  ||..|:..|:...:|:.|.|:: |:|...:|
Mosquito   283 SDVGT--FLQNFIESRKLYTMRKAKEERLVQQLTALER 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_649518.1 Mod_r 19..157 CDD:462117 39/154 (25%)
Vsp37AXP_312401.5 COG5078 15..109 CDD:444052
Mod_r 161..306 CDD:462117 39/154 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.