DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and Vps37c

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001100933.1 Gene:Vps37c / 108348178 RGDID:11384366 Length:353 Species:Rattus norvegicus


Alignment Length:241 Identity:66/241 - (27%)
Similarity:115/241 - (47%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDD---KLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSED 80
            :||:|:.||.:   :|..:..|| |.|:.::......|||.||:|:|.:..:...|..|::..::
  Rat    10 QELEEMQNDPEAIARLALESPEV-QDLQLEREMALATNRSLAEQNLEFQGPLEISRSNLSDKYQE 73

  Fly    81 GRTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLP 145
            .|......||:.::|::.|..:...|.|.|||....:.||::|.|.:||.:.::.:|.||::|..
  Rat    74 LRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLESFSS 138

  Fly   146 IRRTMHLRRLKAEKMQELMRKQR------------------------------QGPGPNTSLP-- 178
            :|..:||||::.||:|:::|:.|                              |.|.|:...|  
  Rat   139 MRTLLHLRRVRVEKLQDVVRRPRALPELAGDAPPKRPPPPRPAPQAAPPETEEQTPQPSVVTPYP 203

  Fly   179 -AYGNVPSSGFYPASGGS---APYPIM-------GPLMPMPPPSRP 213
             .|...|.....|.:.|:   ||:|::       |||.|..|..:|
  Rat   204 LPYSPSPGLPVGPTAQGALQPAPFPVVTQPSSYGGPLGPSYPSPQP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 9/25 (36%)
Mod_r 19..153 CDD:284587 41/136 (30%)
Vps37cNP_001100933.1 Mod_r 5..149 CDD:399880 44/139 (32%)
PHA03247 <194..351 CDD:223021 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353696
Domainoid 1 1.000 82 1.000 Domainoid score I8215
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4859
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm44440
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.