DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps37B and Vps37c

DIOPT Version :9

Sequence 1:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001348887.1 Gene:Vps37c / 107305 MGIID:2147661 Length:352 Species:Mus musculus


Alignment Length:238 Identity:66/238 - (27%)
Similarity:114/238 - (47%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELKELLNDDD---KLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSED 80
            :||:|:.||.:   :|..:..|| |.|:.::......|||.||:|:|.:..:...|..|::..::
Mouse    10 QELEEMQNDPEAIARLALESPEV-QDLQLEREMALATNRSLAEQNLEFQGPLEISRSNLSDKYQE 73

  Fly    81 GRTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLP 145
            .|......||:.::|::.|..:...|.|.|||....:.||::|.|.:||.:.::.:|.||::|..
Mouse    74 LRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLESFSS 138

  Fly   146 IRRTMHLRRLKAEKMQELMRKQR------------------------------QGPGPNTSLP-- 178
            :|..:||||::.||:|:::|:.|                              |.|.|:...|  
Mouse   139 MRTLLHLRRVRVEKLQDVVRRPRALPELAGDVPPKRPPPPRPVPQATPPETEEQPPQPSVVTPYP 203

  Fly   179 -AYGNVPSSGFYPASGGS---APYPIM-------GPLMPMPPP 210
             .|...|.....|.:.|:   ||:|::       |||.|.|.|
Mouse   204 LPYSPSPGLPVGPTAQGALQPAPFPVVAQPSSYGGPLGPYPSP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 9/25 (36%)
Mod_r 19..153 CDD:284587 41/136 (30%)
Vps37cNP_001348887.1 Mod_r 5..149 CDD:369259 44/139 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..352 17/85 (20%)
PHA03247 <184..313 CDD:223021 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850016
Domainoid 1 1.000 83 1.000 Domainoid score I8345
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4943
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197293at2759
OrthoFinder 1 1.000 - - FOG0003711
OrthoInspector 1 1.000 - - otm42377
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5541
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.