DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PUP3

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:43/197 - (21%)
Similarity:73/197 - (37%) Gaps:9/197 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKAL 104
            :.:|:|. .|..||.:.....|.|..:.|..|..:..|....||.. ..::|....|.|.|...|
Yeast     1 MSDPSSI-NGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFH-YGHVFLGITGLATDVTTL 63

  Fly   105 VELTRAQLELHRMNTGFRKVPVCCANQMIRQLLF--RFNGNIDADMIIGGADNTGAHLFCTRSD- 166
            .|:.|.:..|:::... |.:......|::...|:  || |......::.|.::.....|....| 
Yeast    64 NEMFRYKTNLYKLKEE-RAIEPETFTQLVSSSLYERRF-GPYFVGPVVAGINSKSGKPFIAGFDL 126

  Fly   167 -GSTDTA-PFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVR 229
             |..|.| .|...|:.......:.||.:..:|..|........|:......|..||....:.:::
Yeast   127 IGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIK 191

  Fly   230 CD 231
            .|
Yeast   192 KD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 42/192 (22%)
proteasome_beta_type_7 50..239 CDD:239732 40/187 (21%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 41/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.