DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PRE5

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:40/218 - (18%)
Similarity:83/218 - (38%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GGVIIGAESRATSGGIVFSKTC-------RKIIELQANIFAAGAGTARDTKALVELTRAQLELHR 116
            |.|.:|..|...:..:...:..       :|||:...::..:.||.|.|.:.|....|.|     
Yeast    32 GSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQ----- 91

  Fly   117 MNTGFRKVPVCCANQMI--RQLLFRFNGNIDAD-----------------MIIGGADNTGAHLFC 162
                      |..:.::  |:|.....|::..|                 ::|.|.|.:||||..
Yeast    92 ----------CNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLE 146

  Fly   163 TRSDGSTDTAPFTSIGSGYQVSMSILESRWSE----DLSEESACALACDAVAAGMKNDLCSGGKV 223
            .:..|:......|:||:..|.:.:.||.....    |.:.:.......:|::..::::..:...:
Yeast   147 FQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNL 211

  Fly   224 SLCVVRCD--FSVQWPEQLPRQV 244
            |:.:|..|  |::...|.:.:.:
Yeast   212 SIAIVGKDTPFTIYDGEAVAKYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 36/198 (18%)
proteasome_beta_type_7 50..239 CDD:239732 39/211 (18%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.