DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psmb7

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_445984.1 Gene:Psmb7 / 85492 RGDID:621093 Length:277 Species:Rattus norvegicus


Alignment Length:266 Identity:106/266 - (39%)
Similarity:155/266 - (58%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SPFLCGPSGFTFDNCLRNKQLK----ENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIV 75
            |.|.....||:||||.||..|:    :.|.:.|.:..||||:.|:|:..|:::||::|||.|.:|
  Rat     5 SVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVV 69

  Fly    76 FSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVP-VCCANQMIRQLLFR 139
            ..|.|.||..:..||:..|||||.||....:|..:.||||.:.||  ::| |..||:|::|:|||
  Rat    70 ADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTG--RLPRVVTANRMLKQMLFR 132

  Fly   140 FNGNIDADMIIGGADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACAL 204
            :.|.|.|.:::||.|.||.||:.....||||..|:.::|||...:|::.|.::..|:.||.|..|
  Rat   133 YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKL 197

  Fly   205 ACDAVAAGMKNDLCSGGKVSLCVV---RCDFSVQWPEQLPRQVP---PTRTYRLSPKPGRTTILS 263
            ..:|:|||:.|||.||..:.|||:   :.||      ..|..||   .||..|...:.|.|.:|:
  Rat   198 VSEAIAAGIFNDLGSGSNIDLCVISKSKLDF------LRPYSVPNKKGTRFGRYRCEKGTTAVLT 256

  Fly   264 TLVHPV 269
            ..|.|:
  Rat   257 EKVTPL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 92/217 (42%)
proteasome_beta_type_7 50..239 CDD:239732 80/192 (42%)
Psmb7NP_445984.1 proteasome_beta_type_7 44..232 CDD:239732 80/195 (41%)
Pr_beta_C 236..271 CDD:403609 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.