powered by:
Protein Alignment Prosbeta2R2 and SCL1
DIOPT Version :9
Sequence 1: | NP_649515.3 |
Gene: | Prosbeta2R2 / 40621 |
FlyBaseID: | FBgn0037296 |
Length: | 322 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011504.3 |
Gene: | SCL1 / 852873 |
SGDID: | S000002979 |
Length: | 252 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 62 |
Identity: | 13/62 - (20%) |
Similarity: | 23/62 - (37%) |
Gaps: | 8/62 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 TGAHLFC-TRSDGSTDTAPFTSI-GSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKN 215
|.:::|| :|:.|.....|.... .:..:......|.|:..... :.||.:|..|.|
Yeast 68 TVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYD------MPCDVLAKRMAN 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0638 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.