DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and SCL1

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_011504.3 Gene:SCL1 / 852873 SGDID:S000002979 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:13/62 - (20%)
Similarity:23/62 - (37%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 TGAHLFC-TRSDGSTDTAPFTSI-GSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKN 215
            |.:::|| :|:.|.....|.... .:..:......|.|:.....      :.||.:|..|.|
Yeast    68 TVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYD------MPCDVLAKRMAN 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 13/62 (21%)
SCL1NP_011504.3 proteasome_alpha_type_6 12..228 CDD:239723 13/62 (21%)

Return to query results.
Submit another query.