DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PBC2

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_565156.1 Gene:PBC2 / 844080 AraportID:AT1G77440 Length:204 Species:Arabidopsis thaliana


Alignment Length:176 Identity:35/176 - (19%)
Similarity:71/176 - (40%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLE 113
            |:.||.:|......|.::.|........:...::|.::..::|...:|.|.|.:.|.:....:.:
plant     8 GSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQTLYQRLVFRHK 72

  Fly   114 LHRMNTGFRKVPVCCANQMIRQLLF--RFNGNIDADMIIGGADNTGAHLFCTR-SDGSTDTA-PF 174
            |:::.......|...|: ::..:|:  || |......:|.|..:......||. |.|:.:.| .|
plant    73 LYQLREERDMKPETFAS-LVSAILYEKRF-GPFLCQPVIAGLGDDNKPFICTMDSIGAKELAKDF 135

  Fly   175 TSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSG 220
            ...|:..:......|:.:..|:..|........|:.:.:..|..||
plant   136 VVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLSG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 34/175 (19%)
PBC2NP_565156.1 proteasome_beta_type_3 6..200 CDD:239728 35/176 (20%)

Return to query results.
Submit another query.