DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PBB2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_198874.1 Gene:PBB2 / 834056 AraportID:AT5G40580 Length:274 Species:Arabidopsis thaliana


Alignment Length:251 Identity:100/251 - (39%)
Similarity:151/251 - (60%) Gaps:7/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQ 87
            ||:||.|.||..|.:.||:.|:...||||:||::|..|||:||::|||.|.||..|.|.||..:.
plant    13 GFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMA 77

  Fly    88 ANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNGNIDADMIIGG 152
            .||:..|||||.||:|:.::..:||.|||..|| |...|..|..::::.||.:.|::.|.:::||
plant    78 PNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTG-RDSRVVTALTLLKKHLFSYQGHVSAALVLGG 141

  Fly   153 ADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDL 217
            .|.||.||......|||||.||.::|||...:||:.|:::.|.|:.:....|..:|:.:|:.|||
plant   142 VDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAEAICSGIFNDL 206

  Fly   218 CSGGKVSLCVV---RCDFSVQWPEQLPRQVPPTRTYRLSPKPGRTTILSTLVHPVL 270
            .||..|.:||:   ..::...:.|..||....::.|..:.|   |.:|.|.:.|:|
plant   207 GSGSNVDICVITKGHKEYLRNYMEPNPRTYVSSKGYSFTKK---TEVLLTKITPLL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 89/204 (44%)
proteasome_beta_type_7 50..239 CDD:239732 77/191 (40%)
PBB2NP_198874.1 proteasome_beta_type_7 40..228 CDD:239732 77/188 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D977476at2759
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.