DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PBF1

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_191641.1 Gene:PBF1 / 825253 AraportID:AT3G60820 Length:223 Species:Arabidopsis thaliana


Alignment Length:211 Identity:49/211 - (23%)
Similarity:89/211 - (42%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQ-- 111
            |.|.|.|......:|.|::|.::|..:.|:...||.:|......:.:|...|.|||.::.:::  
plant    15 GGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSSSGFQADVKALQKVLKSRHL 79

  Fly   112 LELHRMNTGFRKVPVCCANQMIRQLL------------FRFNGNIDADMIIGGADNTG-AHLFCT 163
            :..|:.|    |...|.|   :.|||            :.||       ::||.|..| ..:|..
plant    80 IYQHQHN----KQMSCPA---MAQLLSNTLYFKRFFPYYAFN-------VLGGLDEEGKGCVFTY 130

  Fly   164 RSDGSTDTAPFTSIGSGYQVSMSILESRW-------------SEDLSEESACALACDAVAAGMKN 215
            .:.||.:...:.:.|||..:.|..|:::.             :..|||..|..|.....|:..:.
plant   131 DAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAVDLVKTVFASATER 195

  Fly   216 DLCSGGKVSLCVVRCD 231
            |:.:|.|:.:.:::.|
plant   196 DIYTGDKLEIMILKAD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 48/210 (23%)
PBF1NP_191641.1 proteasome_beta_type_1 8..223 CDD:239726 49/211 (23%)

Return to query results.
Submit another query.