DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PSMA7

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_002783.1 Gene:PSMA7 / 5688 HGNCID:9536 Length:248 Species:Homo sapiens


Alignment Length:245 Identity:63/245 - (25%)
Similarity:104/245 - (42%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MKYPDRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGG 73
            |.| ||:..:..|.|..|......:.:|:           |:|.||:.....|::|.|.::.: .
Human     1 MSY-DRAITVFSPDGHLFQVEYAQEAVKK-----------GSTAVGVRGRDIVVLGVEKKSVA-K 52

  Fly    74 IVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLF 138
            :...:|.|||..|..|:..|.||...|.:.::...|.:.:.||: |....|.|....:.|..|..
Human    53 LQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRL-TVEDPVTVEYITRYIASLKQ 116

  Fly   139 RF---NGN--IDADMIIGGADNTGA-HLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLS 197
            |:   ||.  .....:|.|.|..|. .|:.|...|:.......:||.|.:.....||..::::..
Human   117 RYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 181

  Fly   198 EESACALACDAVAAGMKNDLCSGGK-VSLCVVRCDFSVQW--PEQLPRQV 244
            |..  .|....|...:...:.|||| :.|.|:|.|.|::.  ||::.:.|
Human   182 ETD--DLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 56/225 (25%)
proteasome_beta_type_7 50..239 CDD:239732 52/197 (26%)
PSMA7NP_002783.1 proteasome_alpha_type_7 3..211 CDD:239724 55/223 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.