DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta5

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster


Alignment Length:234 Identity:62/234 - (26%)
Similarity:108/234 - (46%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FDNCLRN-KQLKENGLEE--PNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQ 87
            |:|.|.| .|::.||.:.  ..:|..|||.:|..|.|||::..:||||.|..:.|::.:||:|:.
  Fly    47 FENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEIN 111

  Fly    88 ANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG-NIDADMIIG 151
            ..:....||.|.|......:...:..||.:... .::.|..|::::..:...:.| .:...|::.
  Fly   112 QFMLGTLAGGAADCVYWDRVLSKECRLHELRNK-ERISVAAASKIMANIAHEYKGMGLSMGMMLA 175

  Fly   152 GADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKND 216
            |.|..|..|:...|:||.......|:|||...:..:|:|.:..||.::.|..|...|:......|
  Fly   176 GYDKRGPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRD 240

  Fly   217 LCSGGKVSLCVVRCD------------FSVQWPEQLPRQ 243
            ..|||.:.:..::.|            ....:.|||.:|
  Fly   241 AYSGGIIRVYHIKEDGWVNISNTDCMELHYMYQEQLKQQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 57/205 (28%)
proteasome_beta_type_7 50..239 CDD:239732 49/201 (24%)
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 58/225 (26%)
proteasome_beta_type_5 74..261 CDD:239730 49/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440965
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.