DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb1

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:248 Identity:52/248 - (20%)
Similarity:97/248 - (39%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NKQLKE---NGLEE----PNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQAN 89
            |.::||   .|..|    |.:| .|.||:.:..:...|:.:::|.:.|..:.|:...|..:|...
Zfish    10 NGKMKEYHYTGPVEHKFSPYAF-NGGTVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDT 73

  Fly    90 IFAAGAGTARDTKALVELTRAQLELHR------MNTGFRKVPVCCANQMIRQLLF--RF------ 140
            .....:|...|...|.::..|:|::::      |.:|       ....|:..:|:  ||      
Zfish    74 TVLGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSG-------AIAAMLSTILYGRRFFPYYVY 131

  Fly   141 NGNIDADMIIGGADNTG-AHLFCTRSDGSTDTAPFTSIGSG---------YQVSMSILESRWSED 195
            |       ||||.|..| ..::.....||.....:.:.||.         .|:....:|:.....
Zfish   132 N-------IIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVP 189

  Fly   196 LSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCDFSVQWPEQLPRQVPPTR 248
            |::|.|..|..|...:..:.|:.:|..:.:|:|.       .|.:..::.|.|
Zfish   190 LTQEKAVQLVKDVFISAAERDVYTGDALKVCIVS-------KEGIKEEIVPLR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 48/226 (21%)
proteasome_beta_type_7 50..239 CDD:239732 41/212 (19%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 48/236 (20%)
proteasome_beta_type_1 26..237 CDD:239726 47/232 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101631
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.