DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb10

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:254 Identity:98/254 - (38%)
Similarity:142/254 - (55%) Gaps:11/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFTFDNCLRN----KQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKI 83
            ||:|:|..||    ..|.|.|...||:..||||:.|:||..|||:||::|||...:|..|.|.||
Zfish    12 GFSFENTRRNAVLEANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKI 76

  Fly    84 IELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNGNIDADM 148
            ..:..||:..|||.|.|.:...::..:.:|||.::|| |...|....:.::|:|||:.|:|.:.:
Zfish    77 HYIAPNIYCCGAGVAADAEVTTQMMSSNVELHSLSTG-RPPLVAMVTRQLKQMLFRYQGHIGSSL 140

  Fly   149 IIGGADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGM 213
            |:||.|..||.|:.....||.|..||.::|||...::|:.|.|:..::..|.|..|..||:.||:
Zfish   141 IVGGVDVNGAQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAITAGI 205

  Fly   214 KNDLCSGGKVSLCVVRCDFSVQWPEQLPRQVPPTR---TYRLSPKPGRTTILSTLVHPV 269
            ..||.||..|.|||: .|..|.:.....:.|...:   |||.  |||.|.:||..|.|:
Zfish   206 FCDLGSGSNVDLCVI-TDKKVDYLRTYDQPVHKNQRGGTYRY--KPGTTAVLSKTVTPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 83/208 (40%)
proteasome_beta_type_7 50..239 CDD:239732 73/188 (39%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 74/185 (40%)
proteasome_beta_type_7 43..231 CDD:239732 73/189 (39%)
Pr_beta_C 237..270 CDD:289249 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.