DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:184 Identity:40/184 - (21%)
Similarity:80/184 - (43%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLE 113
            |...|||:...||:|..|::..| .:....:..::..:..:|....:|...|.:.||:..|...:
  Fly    32 GAPSVGIIASNGVVIATENKHKS-PLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQ 95

  Fly   114 LHRMNTGFRKVPVCCANQMIRQLLFRF--NGNI---DADMIIGGADNTGAHLFCTRSDGSTDTAP 173
            .:.: |....:||....|.:..|:..:  :|.:   ...::|.|.||...:|:.:...|:.....
  Fly    96 TYYL-TYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAYFAWK 159

  Fly   174 FTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGG-KVSLC 226
            .|::|.......:.||.|:||||..:.|...|...:..|.:..:.:.. ::.:|
  Fly   160 ATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFEGKMTADNIEIGIC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 40/184 (22%)
proteasome_beta_type_7 50..239 CDD:239732 39/183 (21%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 40/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.