DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:116 Identity:31/116 - (26%)
Similarity:59/116 - (50%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALV-ELT 108
            |.||||:|:||.:|.||::.|::..:.|.:...:...::.::..||...|:|...|.:::. .:.
  Fly    53 SSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNID 117

  Fly   109 RAQLELHRMNTGFRKVPVCCANQMIRQLLFRFN--GNIDADMIIGGADNTG 157
            :..:|....:......|...|:.|.|.|..|.:  ..:..|:::||.||.|
  Fly   118 QKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 31/116 (27%)
proteasome_beta_type_7 50..239 CDD:239732 27/111 (24%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 26/109 (24%)
PRE1 60..232 CDD:223711 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.