DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosalpha3

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:218 Identity:46/218 - (21%)
Similarity:91/218 - (41%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELH 115
            |.:||:.:.|:::.||.|:|:..:..:....||..|..|:..:.||...|...|....|...:.:
  Fly    33 TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRY 97

  Fly   116 RMNTGFRKVPVCCANQM-----IRQLLFRFNGN--IDADMIIGGADNT-GAHLFCTRSDGSTDTA 172
            :.:.| ..:|  |...:     |:|...::.|.  ....::..|.||. |..|:.:...|:....
  Fly    98 QFSYG-EVIP--CEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGW 159

  Fly   173 PFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCDFSVQWP 237
            ..|.||:.:..::|:|:...::   :|:......||      .||.    :.:..:..|.:...|
  Fly   160 KATCIGNNFGAAISMLKQELAD---KENVKLTLADA------KDLA----IKVLSMTLDTTKLTP 211

  Fly   238 EQLP----RQVPPTRTYRLSPKP 256
            |::.    ::|.....|.:..||
  Fly   212 EKVEMATLQRVDNKTVYSVLEKP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 41/195 (21%)
Prosalpha3NP_476691.1 proteasome_alpha_type_4 3..219 CDD:239721 42/201 (21%)

Return to query results.
Submit another query.