DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:218 Identity:46/218 - (21%)
Similarity:91/218 - (41%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELH 115
            |.:||:.:.|:::.||.|:|:..:..:....||..|..|:..:.||...|...|....|...:.:
  Fly    33 TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRY 97

  Fly   116 RMNTGFRKVPVCCANQM-----IRQLLFRFNGN--IDADMIIGGADNT-GAHLFCTRSDGSTDTA 172
            :.:.| ..:|  |...:     |:|...::.|.  ....::..|.||. |..|:.:...|:....
  Fly    98 QFSYG-EVIP--CEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGW 159

  Fly   173 PFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCDFSVQWP 237
            ..|.||:.:..::|:|:...::   :|:......||      .||.    :.:..:..|.:...|
  Fly   160 KATCIGNNFGAAISMLKQELAD---KENVKLTLADA------KDLA----IKVLSMTLDTTKLTP 211

  Fly   238 EQLP----RQVPPTRTYRLSPKP 256
            |::.    ::|.....|.:..||
  Fly   212 EKVEMATLQRVDNKTVYSVLEKP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 39/184 (21%)
proteasome_beta_type_7 50..239 CDD:239732 41/195 (21%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 46/218 (21%)
proteasome_alpha_type_4 3..219 CDD:239721 42/201 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.