DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:178 Identity:38/178 - (21%)
Similarity:64/178 - (35%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATS------ 71
            |.|.....|.|..|.....:|.::::|           ||:||.....|::..|...||      
  Fly     9 DLSASQFSPDGRVFQIDYASKAVEKSG-----------TVIGIRGKDAVVLAVEKIITSKLYEPD 62

  Fly    72 -GGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRK-VPVCCANQMIR 134
             ||.:|:        ::.||..|.||...|...:.::.|.:...:|..  |.: :|       ::
  Fly    63 AGGRIFT--------IEKNIGMAVAGLVADGNFVADIARQEAANYRQQ--FEQAIP-------LK 110

  Fly   135 QLLFRFNGNIDA------------DMIIGGADNT-GAHLFCTRSDGST 169
            .|..|..|.:.|            .:|:...|.. |..|:.....||:
  Fly   111 HLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIEPSGSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 38/178 (21%)
proteasome_beta_type_7 50..239 CDD:239732 31/141 (22%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 38/178 (21%)
PRE1 6..231 CDD:223711 38/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.