DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:159 Identity:40/159 - (25%)
Similarity:65/159 - (40%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESRATSGGIVFSKTCR-KIIELQANIFAAGAGTARDTKALVELTRAQLEL 114
            |::||.....|::.:::.... .:||.|..: ||..|......|..|...||....:.....|.|
  Fly     5 TILGIKGPDFVMLASDTMQAK-SLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHL 68

  Fly   115 HRMNTGFRKVPVCCANQMIRQLL---FRFNGNIDADMIIGGADNT-GAHLFCTRSDGSTDTAPFT 175
            ::::.|:. :....|....|:.|   .|.|......|::.|.|.. |..|....|.|:..:....
  Fly    69 YKISHGYH-LSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132

  Fly   176 SIGSGYQVSMSILESRWSEDLSEESACAL 204
            ..|.|.....|||:..|:..||:|.|.:|
  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 40/159 (25%)
proteasome_beta_type_7 50..239 CDD:239732 40/159 (25%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 40/159 (25%)
proteasome_beta_type_2 3..194 CDD:239727 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.