DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:197 Identity:61/197 - (30%)
Similarity:92/197 - (46%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RNKQLKENGLEEPN-SFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAG 94
            |....|.|.|.|.. .|..|||.||.|:.||:|:..:||||||.::.|::..|::::...|....
  Fly    52 RESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTT 116

  Fly    95 AGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG-NIDADMIIGGADNTGA 158
            ||.|.|..........:..||.:... .::||..|.:.|..:...:.| .:...|::.|....|.
  Fly   117 AGGAADCTYWDRALTRECRLHELRYK-ERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGP 180

  Fly   159 HLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKV 223
            .|....|:|........::|||...::.||:|.:..|||:..|..||..||......|:.|||.|
  Fly   181 SLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVV 245

  Fly   224 SL 225
            .|
  Fly   246 RL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 61/197 (31%)
proteasome_beta_type_7 50..239 CDD:239732 54/177 (31%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 61/197 (31%)
proteasome_beta_type_5 72..259 CDD:239730 54/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440971
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.