DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb5

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571226.1 Gene:psmb5 / 30387 ZFINID:ZDB-GENE-990415-215 Length:269 Species:Danio rerio


Alignment Length:197 Identity:54/197 - (27%)
Similarity:97/197 - (49%) Gaps:7/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KQLKENGLEEPN---SFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAG 94
            |.|.|:  :||.   .|..|||.:...|..|||:..:||||:|..:.|:|.:|:||:...:....
Zfish    48 KTLGED--DEPERKIEFLHGTTTLAFKFQHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTM 110

  Fly    95 AGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG-NIDADMIIGGADNTGA 158
            ||.|.|......|...|..::.:... .::.|..|::::..:::::.| .:....::.|.|..|.
Zfish   111 AGGAADCSFWERLLARQCRIYELRNK-ERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGP 174

  Fly   159 HLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKV 223
            .|:...|:|:.......::|||...:..:::|....||:.:.||.|...|:......|..|||:|
Zfish   175 GLYYVDSEGNRVCGGLFAVGSGSMYAYGVVDSGLRYDLTIDEACDLGRRAIYQATYRDAYSGGQV 239

  Fly   224 SL 225
            :|
Zfish   240 NL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 54/197 (27%)
proteasome_beta_type_7 50..239 CDD:239732 47/177 (27%)
psmb5NP_571226.1 PTZ00488 44..268 CDD:185666 54/197 (27%)
proteasome_beta_type_5 66..253 CDD:239730 47/177 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.