DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psma5

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:200 Identity:53/200 - (26%)
Similarity:80/200 - (40%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77
            ||......|.|..|.        .|..:|   :...|:|.:||....||.:..|.|.|| .::..
  Rat     9 DRGVNTFSPEGRLFQ--------VEYAIE---AIKLGSTAIGIQTSEGVCLAVEKRITS-PLMEP 61

  Fly    78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG 142
            .:..||:|:.|:|..|.:|...|.|.|::..|.:.:.|.. |....:.|....|.:..|..:| |
  Rat    62 SSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWF-TYNETMTVESVTQAVSNLALQF-G 124

  Fly   143 NIDAD-----------MIIGGADNTGAHLF----------C-TRSDGSTDTAPFTSIGSGYQVSM 185
            ..|||           ::.||.|..|..||          | .|:.||......:|:...|..||
  Rat   125 EEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSM 189

  Fly   186 SILES 190
            ::.|:
  Rat   190 TLKEA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 53/199 (27%)
proteasome_beta_type_7 50..239 CDD:239732 45/162 (28%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 53/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.