DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psma4

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:190 Identity:44/190 - (23%)
Similarity:82/190 - (43%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESR---ATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQL 112
            |.:||:.:.||::.||.|   .....:.||:   ||.:|..::..:.||...|...|....|...
  Rat    33 TCLGILANDGVLLAAERRNIHKLLDEVFFSE---KIYKLNEDMACSVAGITSDANVLTNELRLIA 94

  Fly   113 ELHRMNTGFRKVPVCCANQM-----IRQLLFRFNGNID---ADMIIGGADNTGAHLFCTRSDGST 169
            :.:.:.   .:.|:.|...:     |:|...:|.|...   :.:.||...:.|..|:.:...|:.
  Rat    95 QRYLLQ---YQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNY 156

  Fly   170 DTAPFTSIGSGYQVSMSILESRWSE-DLSEESACALACDAVAAGMKNDLCSGGKVSLCVV 228
            .....|.||:....::|:|:..:.| :::.:||.|||...:...|.....|..||.:..:
  Rat   157 GGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 44/188 (23%)
proteasome_beta_type_7 50..239 CDD:239732 44/190 (23%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 44/188 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.