DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psma1

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus


Alignment Length:154 Identity:38/154 - (24%)
Similarity:63/154 - (40%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLE 113
            |:..||:......::.|..||.|......|   ||:.:..:|..:.||...|.:.|....|.:. 
  Rat    32 GSATVGLKSKTHAVLVALKRAQSELAAHQK---KILHVDNHIGISIAGLTADARLLCNFMRQEC- 92

  Fly   114 LHRMNTGF---RKVPVCCANQMI---RQLLFRFNGN--IDADMIIGGADNTGAHLFCTRSDGSTD 170
               :::.|   |.:||.....:|   .|:..:..|.  ....::|.|.|:.|.|:|.|....:..
  Rat    93 ---LDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYF 154

  Fly   171 TAPFTSIGSGYQVSMSILESRWSE 194
            .....|||:..|.:.:.||...||
  Rat   155 DCRAMSIGARSQSARTYLERHMSE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 37/153 (24%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 38/154 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.