DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psmb2

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:156 Identity:37/156 - (23%)
Similarity:68/156 - (43%) Gaps:3/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHR 116
            ::||.....|::.::..|.|..:.......|:.::...|.....|.|.||....|..:..::|::
Mouse     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly   117 MNTGFRKVPVCCANQMIRQL--LFRFNGNIDADMIIGGAD-NTGAHLFCTRSDGSTDTAPFTSIG 178
            |..|:...|...||...|.|  ..|.......::::.|.| :.|..|:......:...|||.:.|
Mouse    69 MRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHG 133

  Fly   179 SGYQVSMSILESRWSEDLSEESACAL 204
            .|..:::|||:..::..:|.|.|..|
Mouse   134 YGAFLTLSILDRYYTPTISRERAVEL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 37/156 (24%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 37/156 (24%)

Return to query results.
Submit another query.