Sequence 1: | NP_649515.3 | Gene: | Prosbeta2R2 / 40621 | FlyBaseID: | FBgn0037296 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036097.1 | Gene: | Psma5 / 26442 | MGIID: | 1347009 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 53/200 - (26%) |
---|---|---|---|
Similarity: | 80/200 - (40%) | Gaps: | 36/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77
Fly 78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG 142
Fly 143 NIDAD-----------MIIGGADNTGAHLF----------C-TRSDGSTDTAPFTSIGSGYQVSM 185
Fly 186 SILES 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2R2 | NP_649515.3 | PRE1 | 9..228 | CDD:223711 | 53/199 (27%) |
proteasome_beta_type_7 | 50..239 | CDD:239732 | 45/162 (28%) | ||
Psma5 | NP_036097.1 | proteasome_alpha_type_5 | 8..220 | CDD:239722 | 53/199 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |