DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psma4

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:190 Identity:44/190 - (23%)
Similarity:82/190 - (43%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESR---ATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQL 112
            |.:||:.:.||::.||.|   .....:.||:   ||.:|..::..:.||...|...|....|...
Mouse    33 TCLGILANDGVLLAAERRNIHKLLDEVFFSE---KIYKLNEDMACSVAGITSDANVLTNELRLIA 94

  Fly   113 ELHRMNTGFRKVPVCCANQM-----IRQLLFRFNGNID---ADMIIGGADNTGAHLFCTRSDGST 169
            :.:.:.   .:.|:.|...:     |:|...:|.|...   :.:.||...:.|..|:.:...|:.
Mouse    95 QRYLLQ---YQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNY 156

  Fly   170 DTAPFTSIGSGYQVSMSILESRWSE-DLSEESACALACDAVAAGMKNDLCSGGKVSLCVV 228
            .....|.||:....::|:|:..:.| :::.:||.|||...:...|.....|..||.:..:
Mouse   157 GGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 44/190 (23%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 44/188 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.