DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and pup1

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_594544.1 Gene:pup1 / 2541805 PomBaseID:SPAC23D3.07 Length:267 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:82/206 - (39%)
Similarity:128/206 - (62%) Gaps:1/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQ 87
            ||.|:...||..|:|.|...|.:.:||||:||::....:::||::|||:|.|:..|.|:|:..:.
pombe     9 GFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLIS 73

  Fly    88 ANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNGNIDADMIIGG 152
            .||:.||||||.||:.:..:..:.:|||.:.|. ||..|..|..|::|.|||:.|:|.|.:::||
pombe    74 PNIWCAGAGTAADTEFVTSMISSNIELHSLYTN-RKPRVVTALTMLKQHLFRYQGHIGAYLVLGG 137

  Fly   153 ADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDL 217
            .|..|.|||...:.||:|..|:.::|||...::|:||:::..||....|..|..:|:.||:.|||
pombe   138 YDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKYQPDLERHEAMELVKEAIEAGIFNDL 202

  Fly   218 CSGGKVSLCVV 228
            .||....|.|:
pombe   203 GSGSNCDLVVI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 81/204 (40%)
proteasome_beta_type_7 50..239 CDD:239732 71/179 (40%)
pup1NP_594544.1 PRE1 10..237 CDD:223711 81/205 (40%)
proteasome_beta_type_7 36..224 CDD:239732 71/179 (40%)
Pr_beta_C 228..>253 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.