DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and CG30382

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:181 Identity:41/181 - (22%)
Similarity:72/181 - (39%) Gaps:16/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELH 115
            |.|.:......::..:.:.|...|| .:|...:..:..:|..|..|...|:::.|:..|.:....
  Fly    38 TTVALKSGDCAVVATQKKVTEKNIV-PETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANF 101

  Fly   116 RMNTGFR-KVPVCC-----ANQMIRQLLFRFNGN---IDADMIIGGADN-TGAHLFCTRSDGSTD 170
            |...|:. .|.|.|     .||:..|     |..   :...|::...|| .|..::.|...|...
  Fly   102 RYKYGYEMPVDVLCRRIADINQVYTQ-----NAEMRPLGCSMVLIAYDNEIGPSVYKTDPAGYFS 161

  Fly   171 TAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGG 221
            .....|:|:....:.|.||.::..:||||.|..||...:::.:..|....|
  Fly   162 GFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 41/181 (23%)
proteasome_beta_type_7 50..239 CDD:239732 41/181 (23%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 41/181 (23%)
proteasome_alpha_type_6 8..218 CDD:239723 41/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.