DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Psmb1

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:82/210 - (39%) Gaps:39/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVEL 107
            |.:| .|.||:.|..:...|:.:::|.:.|..:.::...|..:|........:|...|...|.::
Mouse    31 PYAF-NGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKI 94

  Fly   108 TRAQLELHR------MNTGFRKVPVCCANQMIRQLLFR--------FNGNIDADMIIGGADNTG- 157
            ..|:|::::      |.||       ....|:..:|:.        :|       ||||.|..| 
Mouse    95 IEARLKMYKHSNNKAMTTG-------AIAAMLSTILYSRRFFPYYVYN-------IIGGLDEEGK 145

  Fly   158 AHLFCTRSDGSTDTAPFTSIGSG---------YQVSMSILESRWSEDLSEESACALACDAVAAGM 213
            ..::.....||.....|.:.||.         .||....:::.....|:.:.|..|..|...:..
Mouse   146 GAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAA 210

  Fly   214 KNDLCSGGKVSLCVV 228
            :.|:.:|..:.:|:|
Mouse   211 ERDVYTGDALRICIV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 42/208 (20%)
proteasome_beta_type_7 50..239 CDD:239732 40/203 (20%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 43/210 (20%)
proteasome_beta_type_1 29..240 CDD:239726 43/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101631
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.