DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and pbs-6

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:202 Identity:42/202 - (20%)
Similarity:84/202 - (41%) Gaps:23/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PNSFTTGTTVVGIVFDGGVIIGAESRATSGGI-VFSKTCRKIIELQANIFAAGAGTARDTKALVE 106
            |.|...|:| ..|..:...|:.:::|.|...| :.::...||..|..||....:|...|...|.:
 Worm    46 PYSMEGGST-CAISGENFAIVASDTRMTQNDINILTRDAEKIQILNDNIILTTSGFYGDVLQLKK 109

  Fly   107 LTRAQLELHRMNTGFRKVPVCCANQMIRQLLFR-----FNGNIDADMIIGGADNTG-AHLFCTRS 165
            :.:::|..:|.:.........||..:.|.|.:|     :.|     .|:.|.|..| ..:|....
 Worm   110 VLQSRLHKYRFDYRSDMSVDLCAELLSRNLYYRRFFPYYTG-----AILAGIDEHGKGAVFSYDP 169

  Fly   166 DGSTDTAPFTSIGSGYQVSMSILESR-----WSE-----DLSEESACALACDAVAAGMKNDLCSG 220
            .|..:...:::.|:...:.:..|:.:     .||     :|:.:.|.:|..|:.....:.::.:|
 Worm   170 IGCIERLGYSASGAAEPMIIPFLDCQIGHVTLSEGYERPELTLDRAISLMKDSFRGAAEREISTG 234

  Fly   221 GKVSLCV 227
            .|:.|.:
 Worm   235 DKIHLVI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 42/202 (21%)
proteasome_beta_type_7 50..239 CDD:239732 39/195 (20%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 42/202 (21%)
Ntn_hydrolase 44..258 CDD:294319 42/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101631
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.